DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG3916

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:274 Identity:76/274 - (27%)
Similarity:117/274 - (42%) Gaps:62/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 NGLGGTVEEVVDQAKPNEFPWTVAL-MQNLINF--FGAGTLVTENIVITAAHLMLDKTINDFGII 138
            || |..|.|.|        |:.|:| ||....:  |..|::|:...|:||||.|....:.|..::
  Fly    32 NG-GQRVNETV--------PFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCMEKMKVEDVSVV 87

  Fly   139 GGAWDLKQLAGKTIQWRTA---TRIVS---HPDFNKMTG-ANNIALIVLETSF-VMKPPIGPICW 195
            .|          |:.|:..   .|:|:   ||.::.... .|:|||:.:...| :.:..|..|..
  Fly    88 VG----------TLNWKAGGLRHRLVTKHVHPQYSMNPRIINDIALVKVTPPFRLERSDISTILI 142

  Fly   196 PTSGVSFDRERCLVAGWGR----------PDFL-AKNYSYKQKKIDLPIVSRSDCESLLRRTAFV 249
            ..|....::....:.|||.          ||.| |.||.         .:|..||..        
  Fly   143 GGSDRIGEKVPVRLTGWGSTSPSTSSATLPDQLQALNYR---------TISNEDCNQ-------- 190

  Fly   250 QSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNIS 314
            :.|::....:||...:|:.||:||.|.||:  .||...  .|||||:.|.|...:..|.:||.:|
  Fly   191 KGFRVTRNEICALAVQGQGACVGDSGGPLI--RPGKQP--HLVGIVSYGSSTCAQGRPDVYTRVS 251

  Fly   315 HMRPWIEKQLNDEL 328
            ...|:|.:.:|.:|
  Fly   252 SFLPYISQVINQDL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 68/256 (27%)
Tryp_SPc 90..320 CDD:214473 67/251 (27%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 73/264 (28%)
Tryp_SPc 31..260 CDD:238113 74/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.