DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG13318

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:339 Identity:104/339 - (30%)
Similarity:153/339 - (45%) Gaps:68/339 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ECVPQGLCKTSAWNQNAISWPSPCQRSE--------------------------------SCCHS 59
            :|||.|.|..          |.|...|:                                :||.:
  Fly    92 QCVPPGSCAN----------PLPTAPSDGSGQIDIRIVNNGGYPTVPTTSSTLTCSYGLVACCQA 146

  Fly    60 SQKLVIGAPLNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAA 124
            ..       ..||:..|...|.|. ....||....:||..||:.....:.|.|.|:|...|:|||
  Fly   147 GS-------YQCGRRFPPPPGSTT-AAPGQASFGAYPWQAALLTTADVYLGGGALITAQHVLTAA 203

  Fly   125 HLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTA-----TRIVSHPDFNKMTGANNIALIVLET-- 182
            |.:.:..:..|.:..|.||    |..|.:...|     :.:..:|.||.....|::|::.|.|  
  Fly   204 HKVYNLGLTYFKVRLGEWD----AASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPV 264

  Fly   183 SFVMKPPIGPICWPTSGVSFDRERCLVAGWGRPDFLAKN-YSYKQKKIDLPIVSRSDCESLLRRT 246
            |...|..:|.:|.||:  ||..:||.|||||:.||.|.. |...::::|:|::..::|::.|:.|
  Fly   265 SLTSKSTVGTVCLPTT--SFVGQRCWVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQAT 327

  Fly   247 AFVQSFQLDPT-ILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALY 310
            ....||.|.|| .:|||||.|:|||.|||||||:|...|   ::.:||:|..|..|....||.:|
  Fly   328 RLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCTSNG---VWYVVGLVAWGIGCAQAGVPGVY 389

  Fly   311 TNISHMRPWIEKQL 324
            .|:....|||:..|
  Fly   390 VNVGTYLPWIQTTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 88/243 (36%)
Tryp_SPc 90..320 CDD:214473 85/238 (36%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 87/241 (36%)
Tryp_SPc 169..399 CDD:214473 85/238 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.