DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Sp7

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:318 Identity:91/318 - (28%)
Similarity:138/318 - (43%) Gaps:44/318 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LCKT---SAWNQNAIS-WPSPCQRSESCCHSSQKLVIG----APLNCGKSNPNGLGGTVEEVVDQ 89
            :|.|   |..:|.|.| .|.|...|.|......:..:|    :|..||   |:.....|....|.
  Fly    82 VCCTSDRSFGSQEATSAAPPPTTTSSSSRGQDGQAGLGNLLPSPPKCG---PHSFSNKVYNGNDT 143

  Fly    90 AKPNEFPWTVALMQNLIN-----FFGAGTLVTENIVITAAHLMLDKTINDFGIIG----GAWD-- 143
            | .:||.| :||::.:.|     ....|:|:....|:||||.::.....:.|.:.    |.:|  
  Fly   144 A-IDEFNW-MALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLGEYDTS 206

  Fly   144 -----LKQLAGKTIQWRTATRIVSHPDF---NKMTGANNIALIVLETSFVMKPPIGPICWP---T 197
                 :..:..:.|......:...||.:   || ...::|||:.|:...|:...|.|:|.|   |
  Fly   207 KDVDCIDDICNQPILQLGIEQATVHPQYDPANK-NRIHDIALLRLDRPVVLNEYIQPVCLPLVST 270

  Fly   198 SGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAG 262
            .......|..:|:||||.. .|:..:.|| ::|||:.....|    .|....::..|..:.||.|
  Fly   271 RMAINTGELLVVSGWGRTT-TARKSTIKQ-RLDLPVNDHDYC----ARKFATRNIHLISSQLCVG 329

  Fly   263 GERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWI 320
            ||..||:|.||.|.|||  ..|....:...|:|:.|..||||..|.:||.::....||
  Fly   330 GEFYRDSCDGDSGGPLM--RRGFDQAWYQEGVVSFGNRCGLEGWPGVYTRVADYMDWI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 75/255 (29%)
Tryp_SPc 90..320 CDD:214473 72/251 (29%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855 0/1 (0%)
Tryp_SPc 136..385 CDD:214473 74/259 (29%)
Tryp_SPc 137..388 CDD:238113 76/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457330
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.