DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG6865

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:293 Identity:81/293 - (27%)
Similarity:129/293 - (44%) Gaps:50/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CHSSQKLVIGAPLNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVI 121
            |..||......|  |...||..:||:      :|:.||.|:.|:||:...:|.| ||:::|..::
  Fly    16 CAQSQIAFSNQP--CSVRNPKIVGGS------EAERNEMPYMVSLMRRGGHFCG-GTIISERWIL 71

  Fly   122 TAAHLMLD------KTINDFGIIGGAWDLKQLAGKTIQWRTATR-----IVSHPDFNKMTGANNI 175
            ||.|.:.:      |.....|:: |...:::..........|.|     ||.||.::.....::|
  Fly    72 TAGHCICNGLQQFMKPAQIQGVV-GLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDI 135

  Fly   176 ALIVLETSFVMKPPIGPICWPT--SGVSFDRERCLVAGWG----------RPDFLAKNYSYKQKK 228
            ||:.|.........|.|.|..:  ...|.::|...|:|||          |.|.|        :|
  Fly   136 ALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDRSDVL--------RK 192

  Fly   229 IDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGR-DACIGDGGSPLMCPIPGHPAIYELV 292
            ..:.|.:...||...|  :..:|..:..|.||||.|.|: |:|..|.|.|||      ...:.||
  Fly   193 ATVKIWNNEACERSYR--SLGKSNTIGETQLCAGYENGQIDSCWADSGGPLM------SKEHHLV 249

  Fly   293 GIVNSGFSCGLENVPALYTNISHMRPWIEKQLN 325
            |:|::|..|....:|.:||.:|....|::|.::
  Fly   250 GVVSTGIGCARPGLPGIYTRVSKYVSWMQKVID 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 71/258 (28%)
Tryp_SPc 90..320 CDD:214473 70/253 (28%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 72/265 (27%)
Tryp_SPc 35..280 CDD:238113 73/268 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.