DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG7542

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:256 Identity:63/256 - (24%)
Similarity:106/256 - (41%) Gaps:36/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 VEEVVDQAKPNE---FPWTVALMQNLINF--FGAGTLVTENIVITAAHLMLDKTINDFGIIGGAW 142
            ||..:...:|.|   ||:...|..:..|:  :..|||::...:|||||.|  .......:..||.
  Fly    23 VEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCM--DGAESVTVYLGAI 85

  Fly   143 DL--KQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWP--TSG--VS 201
            ::  :...|:.......:.|:.|.::...|..|:|:||.|.........|.....|  .:|  .:
  Fly    86 NIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPT 150

  Fly   202 FDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERG 266
            ::..|...:||||....:.:.|...:.:::||:..|.|.       ...|..:...::|.....|
  Fly   151 YESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCR-------MYWSGAVSEKMICMSTTSG 208

  Fly   267 RDACIGDGGSPLMCPIPGHPAIYE------LVGIVNSGFSCGLE-NVPALYTNISHMRPWI 320
            :..|.||.|.||         :|:      |:|..:.|.|.|.: ..||::|.||....||
  Fly   209 KSTCHGDSGGPL---------VYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 61/251 (24%)
Tryp_SPc 90..320 CDD:214473 59/247 (24%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 61/252 (24%)
Tryp_SPc 27..260 CDD:214473 59/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.