DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG4998

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:293 Identity:97/293 - (33%)
Similarity:148/293 - (50%) Gaps:31/293 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 CQRSESCCHSSQKLVIGAPL----NCGKSNPNGLGGTVEEVV---DQAKPNEFPWTVALM----Q 103
            |:.:|.||.  :.|...||.    .||..|..|:.|.::..|   ..::..|:||.||::    :
  Fly   898 CRINEVCCR--RPLRPQAPPQQFGRCGVRNAAGITGRIKNPVYVDGDSEFGEYPWHVAILKKDPK 960

  Fly   104 NLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQW-----RTATRIVSH 163
            ..|...| |||:....:|:|||.:..:...|..:..|.||:..    .:::     |....:..|
  Fly   961 ESIYACG-GTLIDAQHIISAAHCIKSQNGFDLRVRLGEWDVNH----DVEFFPYIERDVVSVHIH 1020

  Fly   164 PDFNKMTGANNIALIVLE--TSFVMKPPIGPICWPTSGVSFDRERCLVAGWGRPDFLAKNYSYKQ 226
            |::...|..|::|::.|:  ..|...|.|.|.|.|.....|...||...|||: |...::..|:.
  Fly  1021 PEYYAGTLDNDLAVLKLDQPVDFTKNPHISPACLPDKYSDFTGARCWTTGWGK-DAFGEHGKYQN 1084

  Fly   227 --KKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIY 289
              |::|:||:|...|||.||.|....|::|:|..:|||||.|:|||.||||.||:|...|   ..
  Fly  1085 ILKEVDVPILSHQQCESQLRNTRLGYSYKLNPGFVCAGGEEGKDACKGDGGGPLVCDRNG---AM 1146

  Fly   290 ELVGIVNSGFSCGLENVPALYTNISHMRPWIEK 322
            .:||:|:.|..||..|||.:|..:|...|||::
  Fly  1147 HVVGVVSWGIGCGQVNVPGVYVKVSAYLPWIQQ 1179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 84/248 (34%)
Tryp_SPc 90..320 CDD:214473 82/242 (34%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 84/247 (34%)
Tryp_SPc 942..1177 CDD:214473 82/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.