DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG10663

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:277 Identity:73/277 - (26%)
Similarity:117/277 - (42%) Gaps:35/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LNCG--------KSNPNGL---GGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVIT 122
            |:||        :|..|.|   ||..      |:..|:||.||::......|..|||:....|:|
  Fly   487 LSCGIVRSGTGRRSMSNMLKIIGGRA------ARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLT 545

  Fly   123 AAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMK 187
            |||.:.....    :..|..:|....|..||.| ..:..:||:|:|.|..:::||:.|..:....
  Fly   546 AAHCVRKVLF----VRIGEHNLNYEDGTEIQLR-VMKSYTHPNFDKRTVDSDVALLRLPKAVNAT 605

  Fly   188 PPIGPICWPTSGVSFDRE-RCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQS 251
            ..||..|.|....:..:. .|.:.|||:........:....|..:||:...:|..:      ...
  Fly   606 TWIGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKV------YYD 664

  Fly   252 FQLDPTILCAGGERGR-DACIGDGGSPLMC---PIPGHPAIYELVGIVNSGFSCGLENVPALYTN 312
            :.:...:.|||.::|. |.|.||.|.||:|   ..|.||  :.:.||.:.|..|...|...:|..
  Fly   665 YTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHP--WTIFGITSFGDGCAQRNKFGIYAK 727

  Fly   313 ISHMRPWIEKQLNDELN 329
            :.:...|:...:|.:.|
  Fly   728 VPNYVDWVWSVVNCDGN 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 63/239 (26%)
Tryp_SPc 90..320 CDD:214473 62/234 (26%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 64/247 (26%)
Tryp_SPc 507..735 CDD:238113 64/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.