DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG18180

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:291 Identity:74/291 - (25%)
Similarity:113/291 - (38%) Gaps:67/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LVIGAPLNCGKSNPNGLGGT--VEEVVDQAKPNEFPWTVALMQNLINFF-----------GAGTL 114
            |.:.|.|....::|.||..|  :.:..:....|.:|........::..|           ||||:
  Fly     6 LTLSAALALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTI 70

  Fly   115 VTENIVITAAHLMLDKTINDFGII--GGAWDLKQLAGKTIQWRTATR-------IVSHPDFNKMT 170
            :..:.::||||.:    ..|:..|  |..|.          |..|.|       .:||||:... 
  Fly    71 IANDWILTAAHCL----TGDYVEIHYGSNWG----------WNGAYRQTVRRDNFISHPDWPSQ- 120

  Fly   171 GANNIALI----VLETSFVMKPPIGPICWPTSGVSFDRER---CLVAGWGRPDFLAKNYSYKQKK 228
            |..:|.||    |.....:.|.|:     |:.....||.:   |:..|||..|  ..|.:...:.
  Fly   121 GGRDIGLIRTPHVDFNGLINKIPL-----PSMNEQNDRYQDTWCVACGWGGMD--NGNLADWLQC 178

  Fly   229 IDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVG 293
            :|:.|:|.|:||......|        .|.:|.....|:..|.||.|.||:.    |... .|||
  Fly   179 VDVQIISNSECEQAYGSVA--------STDMCTRHADGKSVCGGDSGGPLVT----HDNA-RLVG 230

  Fly   294 IVN-SGFSCGLENVPALYTNISHMRPWIEKQ 323
            ::. :..||  .:.|:.||.:|....||..|
  Fly   231 VITFASVSC--HDGPSGYTRVSDYLEWIRDQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 66/262 (25%)
Tryp_SPc 90..320 CDD:214473 64/257 (25%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 64/257 (25%)
Tryp_SPc 36..259 CDD:238113 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.