DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG10469

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:260 Identity:69/260 - (26%)
Similarity:113/260 - (43%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LGGTVEEVVDQAKPNEFPWTVALMQNLINFFGA--------GTLVTENIVITAAHLMLDKTINDF 135
            :.||.      ||..:.|:.|.|   |..|.|:        ||:::...:|||||.:.|...|.:
  Fly    25 MNGTA------AKAKQLPYQVGL---LCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLW 80

  Fly   136 GIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGV 200
            .::.....:|....|.|....:..|| |..|::.|..|:||||.|.........|.|...|::..
  Fly    81 KVLIHVGKVKSFDDKEIVVNRSYTIV-HKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKK 144

  Fly   201 SFDRERCLVAGWGRPDFLAKNYSYKQ------KKIDLPIVSRSDCESLLRRTAFVQSFQ-LDPTI 258
            ::...:.:::|||        .:.||      :.|..||:|..:||....:....:|.: :....
  Fly   145 TYTGRKAIISGWG--------LTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGF 201

  Fly   259 LCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGF--SCGLENVPALYTNISHMRPWIE 321
            :|...::|. .|.||.|.|::.    ......|||||:.||  .|.|: :|.:.|.:|....||:
  Fly   202 ICIDSKKGL-PCRGDSGGPMVL----DDGSRTLVGIVSHGFDGECKLK-LPDVSTRVSSYLKWIK 260

  Fly   322  321
              Fly   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 67/251 (27%)
Tryp_SPc 90..320 CDD:214473 65/246 (26%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 67/257 (26%)
Tryp_SPc 24..260 CDD:238113 68/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.