DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and thetaTry

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:246 Identity:63/246 - (25%)
Similarity:107/246 - (43%) Gaps:58/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTI------------NDFGIIGGAWDL---K 145
            |:.|:|.....:.|..|:|:.|:.|:||||.::.:.:            |:.||:....:|   :
  Fly    47 PYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNE 111

  Fly   146 QLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLVA 210
            ....||:::......:.    .|:....||..|.|.|.   .||.|     |:.|        |.
  Fly   112 DYNSKTMEYDVGILKLD----EKVKETENIRYIELATE---TPPTG-----TTAV--------VT 156

  Fly   211 GWGRPDFLAKNYSY------KQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDA 269
            |||     :|.|.:      ..:::.:.||....|.|    ..:.....:..:::|| .|:.:||
  Fly   157 GWG-----SKCYFWCMTLPKTLQEVYVNIVDWKTCAS----DEYKYGEIIYDSMVCA-YEKKKDA 211

  Fly   270 CIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWI 320
            |.||.|.||..   |:    .|||||:.|::|....:|.:|:::..:|.||
  Fly   212 CQGDSGGPLAV---GN----TLVGIVSWGYACASNLLPGVYSDVPALRKWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 63/246 (26%)
Tryp_SPc 90..320 CDD:214473 61/244 (25%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 61/244 (25%)
Tryp_SPc 35..255 CDD:238113 61/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.