DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and flz

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:245 Identity:68/245 - (27%)
Similarity:107/245 - (43%) Gaps:37/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 FPWTVALMQNL-INFFG----AGTLVTENIVITAAHLM------LDKTINDFGIIGGAWDLKQLA 148
            :||.|.:.::. :..|.    .|.|:|...||||||..      |...:.:|.|.|   ||:...
  Fly  1460 YPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHCQPGFLASLVAVMGEFDISG---DLESKR 1521

  Fly   149 GKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLVAGWG 213
            ..|   :...|::.|..::..|..|::||:.|::.......|.|||.|.....|......|.|||
  Fly  1522 SVT---KNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICMPNDVADFTGRMATVTGWG 1583

  Fly   214 R-------PDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERG-RDAC 270
            |       |..|        :::.:||:..|.|:.:.....  .:.::..:.||||...| :|:|
  Fly  1584 RLKYGGGVPSVL--------QEVQVPIIENSVCQEMFHTAG--HNKKILTSFLCAGYANGQKDSC 1638

  Fly   271 IGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWI 320
            .||.|.||:...|  ...|||.|.|:.|..|....:|.:|...:..:||:
  Fly  1639 EGDSGGPLVLQRP--DGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 68/245 (28%)
Tryp_SPc 90..320 CDD:214473 67/243 (28%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 68/245 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457728
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.