DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and SPH93

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:260 Identity:109/260 - (41%)
Similarity:149/260 - (57%) Gaps:10/260 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTI-N 133
            :||.||.|||.......:|||:|.::||.||:..| ..:...|:|:..|:|:|.||.::  || .
  Fly   232 SCGMSNANGLQMVEGITIDQARPAQYPWAVAIFHN-GQYLAGGSLIQPNVVLTVAHRVI--TIET 293

  Fly   134 DFGIIGGAWDLKQLAGKTI---QWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICW 195
            :..:..|.||||  :.:.|   :.|...|.|.|..|:..:||||:||:.|.:.|.:...|..||.
  Fly   294 ELVVRAGDWDLK--SDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICL 356

  Fly   196 PTSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILC 260
            ||...||...||.|||||:..:..:.||...||:.|.:|:|:.||..||.|.....|:|...|:|
  Fly   357 PTPNKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIIC 421

  Fly   261 AGGERGRDACIGDGGSPLMCPIPG-HPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQL 324
            ||||.|||.|.|||||.|.|.|.| :..:||..||||.|..||.|.:||:||.:|....||.::|
  Fly   422 AGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITEKL 486

  Fly   325  324
              Fly   487  486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 101/239 (42%)
Tryp_SPc 90..320 CDD:214473 97/234 (41%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 101/239 (42%)
Tryp_SPc 252..482 CDD:214473 97/234 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471499
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.