DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG4793

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:324 Identity:113/324 - (34%)
Similarity:167/324 - (51%) Gaps:20/324 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CGLQM--ECVPQGLCKTSAWNQNAI-------SWPSPCQRSESCCHSSQKLVIGA-------PLN 70
            ||..|  |||.:..|:........|       :....|:..::||..::.|....       |..
  Fly    21 CGGSMAKECVQRNRCRIGTETGRPIIDFRGLNNGNQGCESGQTCCPKTEILQYPVQADNQPLPTE 85

  Fly    71 CGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINF-FGAGTLVTENIVITAAHLMLDKTIND 134
            ||..|..|:|.|:....|.|:..|.||.|||:.:.... .|.|:|:|.::|:|::...|:.....
  Fly    86 CGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKY 150

  Fly   135 FGIIGGAWDLKQLAGKTIQWRTATR-IVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTS 198
            ..:..|.||.:.:..:......|.| ||.|.:.:...||||.||:.|.....:...||.||.|..
  Fly   151 LIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPP 215

  Fly   199 GVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGG 263
            ..:|...||:|:|||:...|..:|....|||:||:|.||.|::.| :..:.:.|.||.:::||||
  Fly   216 NRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKL-QGPYGKDFILDNSLICAGG 279

  Fly   264 ERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLNDE 327
            |.|:|.|.||||:||.||:...|..|||:||||.||.|| ..:||.||::|.:|.||:..:..|
  Fly   280 EPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCG-GPLPAAYTDVSQIRSWIDNCIQAE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 93/236 (39%)
Tryp_SPc 90..320 CDD:214473 90/231 (39%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 92/233 (39%)
Tryp_SPc 105..335 CDD:214473 90/231 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471551
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.