DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:313 Identity:92/313 - (29%)
Similarity:139/313 - (44%) Gaps:67/313 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SWPSPCQRSESCCH-----SSQKLVIGAPLNCGKSNPNGLGGTVEEVVD--QAKPNEFPWTVALM 102
            |:|||...:.:...     ||:    |.||.||..||  :....|.:|.  .|.|:||||...|.
  Fly   360 SYPSPVTTTTTTRRPVSGTSSE----GLPLQCGNKNP--VTPDQERIVGGINASPHEFPWIAVLF 418

  Fly   103 QNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTAT--------- 158
            ::...|.| |:|:|.:.::||||.:...|         :||:..|......:...|         
  Fly   419 KSGKQFCG-GSLITNSHILTAAHCVARMT---------SWDVAALTAHLGDYNIGTDFEVQHVSR 473

  Fly   159 ---RIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTS----GVSFDRERCLVAGWG--- 213
               |:|.|..|...|..|::|::.|.........|.|||.|||    ..|:..:...|||||   
  Fly   474 RIKRLVRHKGFEFSTLHNDVAILTLSEPVPFTREIQPICLPTSPSQQSRSYSGQVATVAGWGSLR 538

  Fly   214 ----RPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTA---FVQSFQLDPTILCAGGERGRDACI 271
                :|..|        :|:|:||.:.::|.....|.|   .::|      ::|| |:..:|:|.
  Fly   539 ENGPQPSIL--------QKVDIPIWTNAECARKYGRAAPGGIIES------MICA-GQAAKDSCS 588

  Fly   272 GDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQL 324
            ||.|.|::....|.   |..||||:.|..||....|.:||.::.:.|||.|.:
  Fly   589 GDSGGPMVINDGGR---YTQVGIVSWGIGCGKGQYPGVYTRVTSLLPWIYKNI 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 76/262 (29%)
Tryp_SPc 90..320 CDD:214473 74/255 (29%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 75/262 (29%)
Tryp_SPc 400..637 CDD:238113 77/264 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.