DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and PRSS38

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:268 Identity:71/268 - (26%)
Similarity:124/268 - (46%) Gaps:26/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SQKLVIGAPLNCGKSNPNG--LGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVIT 122
            :|.:.:...:.||:.:..|  |||.      .|...::||.|::....::..| |:::.|..|::
Human    40 NQGISLTGSVACGRPSMEGKILGGV------PAPERKWPWQVSVHYAGLHVCG-GSILNEYWVLS 97

  Fly   123 AAHLM-LDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTG-ANNIALIVLETSFV 185
            |||.. .||.|..:.:..|..:|: :||...||....|::.||.:..... ..::||:.|:|..|
Human    98 AAHCFHRDKNIKIYDMYVGLVNLR-VAGNHTQWYEVNRVILHPTYEMYHPIGGDVALVQLKTRIV 161

  Fly   186 MKPPIGPICWPTSGVSFDRERCLVAGWGRPDFLAK--NYSYKQKKIDLPIVSRSDCESLLRRTAF 248
            ....:.|:|..|..|:.....|...|||   .::|  ..|.:.:::.||::....|..|....::
Human   162 FSESVLPVCLATPEVNLTSANCWATGWG---LVSKQGETSDELQEMQLPLILEPWCHLLYGHMSY 223

  Fly   249 VQSFQLDPTILCAGG-ERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTN 312
            :.     |.:||||. ...:..|.||.|.||:|..   ...:..:|||:.|..|.....|.:|.:
Human   224 IM-----PDMLCAGDILNAKTVCEGDSGGPLVCEF---NRSWLQIGIVSWGRGCSNPLYPGVYAS 280

  Fly   313 ISHMRPWI 320
            :|:...||
Human   281 VSYFSKWI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 64/238 (27%)
Tryp_SPc 90..320 CDD:214473 62/234 (26%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 67/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.