DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG31954

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:312 Identity:78/312 - (25%)
Similarity:139/312 - (44%) Gaps:63/312 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MEC---VPQGLCKTSAWNQNAISWPSPCQRSESCCHSSQKLVIGAPLNCGKSNP--NG--LGGTV 83
            ::|   |..|:|..          |.|.:|..|.     :.||..|   .|.:|  :|  :||..
  Fly    10 LQCSLLVLAGVCLI----------PQPVKRQRSL-----EDVIKNP---WKLSPRLDGRIVGGHR 56

  Fly    84 EEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLA 148
            ..:.|.      |..|:|..:  :....|::::|..::||||....||.:...:..|..:..: :
  Fly    57 INITDA------PHQVSLQTS--SHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFAR-S 112

  Fly   149 GKTIQWRTATRIVSHPDFNKMTGANNIALIVL-------ETSFVMKPPIGPICWPTSGVSFDRER 206
            |:.::   ..:||.|..||......:.:|:.|       ||...:|.|...:.:      .|.|.
  Fly   113 GQLLR---VQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKY------MDGEA 168

  Fly   207 CLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGG-ERGRDAC 270
            |.|:|||....|.::..: .:::::|:|::..|....::...|..     .::|||. |.|:|||
  Fly   169 CFVSGWGNTQNLLESREW-LRQVEVPLVNQELCSEKYKQYGGVTE-----RMICAGFLEGGKDAC 227

  Fly   271 IGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEK 322
            .||.|.|::....      ||||:|:.|:.|...:.|.:|:.:|..|.||::
  Fly   228 QGDSGGPMVSESG------ELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 62/243 (26%)
Tryp_SPc 90..320 CDD:214473 59/237 (25%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 62/250 (25%)
Tryp_SPc 51..274 CDD:238113 64/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.