DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and prss60.3

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:358 Identity:84/358 - (23%)
Similarity:136/358 - (37%) Gaps:112/358 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRRVIFIRCCFWTLTETGAPCGLQMECVPQGLCKTSAWNQNAISWPSPCQRSESCCHSSQKLVI 65
            |||    :.|...||          :.||...|.:.:...|                        
Zfish     3 MWR----LTCATLTL----------LICVKGSLSQLNVCGQ------------------------ 29

  Fly    66 GAPLNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVAL-MQNLINFFGAGTLVTENIVITAAHLMLD 129
             |||     |...:||.      .|.|..:||.|:| .......|..|:|::...|:||||.:  
Zfish    30 -APL-----NTRIVGGV------NASPGSWPWQVSLHSPKYGGHFCGGSLISSEWVLTAAHCL-- 80

  Fly   130 KTINDFGIIGGAWDLKQLAGKTIQ----WRTATRIVS---HPDFNKMTGANNIALIVLETSFVMK 187
            ..:::..::      ..|..:|.|    :.|:..:..   |..:|..|..|:|||:.|.::....
Zfish    81 SGVSETTLV------VYLGRRTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFT 139

  Fly   188 PPIGPICWP------TSGVSFDRERCLVAGWG---------RPDFLAKNYSYKQKKIDLPIVSRS 237
            ..|.|:|..      ::|.|     ..:.|||         .|..|.:..        :|:|:..
Zfish   140 NYIRPVCLAAQNSVYSAGTS-----SWITGWGDIQAGVNLPAPGILQETM--------IPVVAND 191

  Fly   238 DCESLLRRTAFVQSFQLDPTILCAG-GERGRDACIGDGGSPL---MCPIPGHPAIYELVGIVNSG 298
            .|.:||      .|..:...::||| .:.|:|.|.||.|.|:   :|      .::...||.:.|
Zfish   192 RCNALL------GSGTVTNNMICAGLTQGGKDTCQGDSGGPMVTRLC------TVWVQAGITSWG 244

  Fly   299 FSCGLENVPALYTNISHMRPWIEKQLNDELNKP 331
            :.|...|.|.:||.:|..:.||..:::  ||||
Zfish   245 YGCADPNSPGVYTRVSQYQSWISSKIS--LNKP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 64/261 (25%)
Tryp_SPc 90..320 CDD:214473 62/256 (24%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 66/271 (24%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.