DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG1304

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:280 Identity:76/280 - (27%)
Similarity:124/280 - (44%) Gaps:61/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LVIGAPLNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLM 127
            |::..|::   |.|..|.|.|....|..| |:||..|:| :|..:....|::::.|.|:||||.:
  Fly    15 LLLAVPVH---SAPGSLNGRVVGGEDAVK-NQFPHQVSL-RNAGSHSCGGSILSRNYVLTAAHCV 74

  Fly   128 LDKTIND---------FGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETS 183
            .::..|.         |.|..|:.| :...|..:|   ...::.|.::...  .|::||:.||:.
  Fly    75 TNQDSNGNSVPIAAERFTIRAGSND-RFSGGVLVQ---VAEVIVHEEYGNF--LNDVALLRLESP 133

  Fly   184 FVMKPPIGPICWPTSGVSFDRERCLVAGWGR-------PDFLAKNYSYKQKKIDLPIVSRSDCES 241
            .::...|.||..||:....|.: .:::||||       |.:|..|        .|..:|...|:.
  Fly   134 LILSASIQPIDLPTADTPADVD-VIISGWGRIKHQGDLPRYLQYN--------TLKSISLERCDE 189

  Fly   242 LLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIY--ELVGIVNSGF---SC 301
            |:...  |||      .||...|....||.||.|.         ||:|  ::||:  :||   :|
  Fly   190 LIGWG--VQS------ELCLIHEADNGACNGDSGG---------PAVYNNQVVGV--AGFVWSAC 235

  Fly   302 GLENVPALYTNISHMRPWIE 321
            | .:.|..|..:.:...||:
  Fly   236 G-TSYPDGYARVYYHNEWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 69/255 (27%)
Tryp_SPc 90..320 CDD:214473 66/250 (26%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 68/258 (26%)
Tryp_SPc 32..256 CDD:238113 70/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.