DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Ser6

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:280 Identity:75/280 - (26%)
Similarity:121/280 - (43%) Gaps:66/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VIGAPLNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLML 128
            |..||   ||.|...:||      :.|..|:||..|:| :|..:....|:::|...::||||.:.
  Fly    21 VQSAP---GKLNGRVVGG------EDAVKNQFPHQVSL-RNAGSHSCGGSILTRTYILTAAHCVS 75

  Fly   129 DKTIND---------FGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSF 184
            ::.:|.         |.|..|:.| :...|..:|   ...::.|.::...  .|::||:.||:..
  Fly    76 NEDVNHVITPIAAERFTIRAGSND-RFSGGVLVQ---VAEVIVHEEYGNF--LNDVALLRLESPL 134

  Fly   185 VMKPPIGPICWPTSGVSFDRERCLVAGWGR-------PDFLAKNYSYKQKKIDLPIVSRSDCESL 242
            ::...|.||..||.....|.: .:::||||       |.:|..|        .|..::|..||.|
  Fly   135 ILSASIQPIDLPTVDTPADVD-VVISGWGRIKHQGDLPRYLQYN--------TLKSITRQQCEEL 190

  Fly   243 LRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIY--ELVGIVNSGF---SCG 302
            :       .|..:.. ||...:....||.||.|.         ||:|  :|||:  :||   .||
  Fly   191 I-------DFGFEGE-LCLLHQVDNGACNGDSGG---------PAVYNNQLVGV--AGFVVDGCG 236

  Fly   303 LENVPALYTNISHMRPWIEK 322
             ...|..|..:.:.:.||:|
  Fly   237 -STYPDGYARVFYFKDWIKK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 67/256 (26%)
Tryp_SPc 90..320 CDD:214473 64/250 (26%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 66/263 (25%)
Tryp_SPc 32..256 CDD:238113 69/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.