DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP010243

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_554157.3 Gene:AgaP_AGAP010243 / 3292148 VectorBaseID:AGAP010243 Length:275 Species:Anopheles gambiae


Alignment Length:261 Identity:71/261 - (27%)
Similarity:121/261 - (46%) Gaps:35/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGI- 137
            ||...:||.|.::      ...|:.|: ::.|......|:::|...|:||.|.:.|.......: 
Mosquito    43 SNSLIVGGHVVDI------EMHPYQVS-VRELNEHICGGSIITNRWVLTAGHCVDDTIAAYMNVR 100

  Fly   138 IGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPI--CWPTSGV 200
            :|.|:..|   |.||  .....:.:|||....:...:.||:.|:.:.|......||  .:.....
Mosquito   101 VGSAFYAK---GGTI--HPVDSVTTHPDHVPYSWLADFALLQLKHAIVFSTIAQPIALAFRLDNA 160

  Fly   201 SFDRERCLVAGWGRPDFLAKNYSY-KQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGG- 263
            ..||| |:|.||||.  |.:..|: |.:.:.:|:|||..|.:       ....::|.|::|||. 
Mosquito   161 LSDRE-CVVTGWGRT--LNEEESFDKLRAVQIPLVSRVLCNA-------TYEGKIDQTMICAGDF 215

  Fly   264 -ERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLNDE 327
             :.|:.:|..|.|.||:|   |...    ||||:.|..|.:...|.:|:::.:.|.||...:::.
Mosquito   216 VDGGKGSCAYDSGGPLVC---GDMQ----VGIVSWGKGCAMPGYPDVYSSVLYARAWINSIVHNS 273

  Fly   328 L 328
            :
Mosquito   274 I 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 66/240 (28%)
Tryp_SPc 90..320 CDD:214473 64/235 (27%)
AgaP_AGAP010243XP_554157.3 Tryp_SPc 47..269 CDD:238113 69/250 (28%)
Tryp_SPc 47..266 CDD:214473 67/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.