DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP007141

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_565054.3 Gene:AgaP_AGAP007141 / 3290313 VectorBaseID:AGAP007141 Length:254 Species:Anopheles gambiae


Alignment Length:273 Identity:71/273 - (26%)
Similarity:107/273 - (39%) Gaps:58/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGI 137
            :.|...:|||      .|.|...|:.|:| |.|......|.::..:.::||||.:  :|...|  
Mosquito    26 EGNDRVVGGT------DAPPGAAPYQVSL-QGLFGHSCGGAIIDRDWILTAAHCV--QTSVKF-- 79

  Fly   138 IGGAWDLKQLAGKTI-----QWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPT 197
                  .|.|.|..:     |.....:...|..:|.....|:|||:.|::.......:.||.:..
Mosquito    80 ------TKVLVGTNLLNAGGQRYAVEKFYVHSRYNNPVFHNDIALVKLKSMIQYDDLVQPIAYSE 138

  Fly   198 SGVSFDRERCLVAGWGR-------PDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLD 255
            ..:. :.....:.||||       |:        |.:.|||..|...:|:.|     ...|..:|
Mosquito   139 REIP-ENATLTLTGWGRLSGTGAMPN--------KLQTIDLTYVPYEECKRL-----HGNSENVD 189

  Fly   256 PTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYE--LVGIVNSGFSCGLENVPALYTNISHMRP 318
            ...:|...::|..||.||.|.||         :||  |||:||.|..|.| ..|..|..:|:...
Mosquito   190 IGHVCTLTKKGEGACNGDSGGPL---------VYEGKLVGVVNFGVPCAL-GYPDAYARVSYYHD 244

  Fly   319 WIEKQLNDELNKP 331
            ||...:   .|.|
Mosquito   245 WIRTTI---ANNP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 65/248 (26%)
Tryp_SPc 90..320 CDD:214473 63/243 (26%)
AgaP_AGAP007141XP_565054.3 Tryp_SPc 30..246 CDD:214473 66/256 (26%)
Tryp_SPc 31..249 CDD:238113 68/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.