DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG4653

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:266 Identity:68/266 - (25%)
Similarity:114/266 - (42%) Gaps:60/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGG----- 140
            |.|:.....|:....|.:::|.:|.::..| |.|:.|..::||||.:         .:||     
  Fly    22 GVVQSSRLPAEVGSQPHSISLRRNGVHVCG-GALIREKWILTAAHCV---------SLGGGQQSY 76

  Fly   141 --------AWDLKQLAGKTIQWRTATRIVSHPDFNK--MTGANNIALIVLETSFVMKPPIGPICW 195
                    ...:::|.|.  |....::|:.|.:::.  ..|:|::||:.||||.|:.....||..
  Fly    77 PAKSYNVRVGSIQRLTGG--QLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDL 139

  Fly   196 ----PTSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDP 256
                |.:|     .:.:.:|||... :..:.|:..:......:|.|||::.|    ::|  |.|.
  Fly   140 ATERPAAG-----SQIIFSGWGSSQ-VDGSLSHVLQVATRQSLSASDCQTEL----YLQ--QEDL 192

  Fly   257 TILCAGGERGRDACIGDGGSPLMCPIPGHPAIY--ELVGIVN---SGFSCGLENVPALYTNISHM 316
            ..|....|.....|.||.|:         ||.|  :||||..   ||  ||.|. |..|.:::..
  Fly   193 LCLSPVDEDFAGLCSGDAGA---------PASYNNQLVGIAAFFVSG--CGSEQ-PDGYVDVTQH 245

  Fly   317 RPWIEK 322
            ..||.:
  Fly   246 LEWINE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 66/259 (25%)
Tryp_SPc 90..320 CDD:214473 64/253 (25%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 66/258 (26%)
Tryp_SPc 30..249 CDD:214473 64/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457627
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.