DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG9676

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:265 Identity:66/265 - (24%)
Similarity:115/265 - (43%) Gaps:59/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGG 140
            |..:|||      :|:..:||..::|.:...:..| |::::::.|:||||.:  |..|:   :..
  Fly    26 PRIVGGT------KAREGQFPHQISLRRRGSHTCG-GSIISKDYVVTAAHCV--KQGNN---VAP 78

  Fly   141 AWDLKQLAGKTIQWRTATR-----IVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICW----P 196
            |.:|:..||..:......|     :..||::|  :..:::|::.|..|......|..|..    |
  Fly    79 ANELEIQAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIKLATEDP 141

  Fly   197 TSGVSFDRERCLVAGWGR-----PDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDP 256
            .:..:.|     ::|||.     |  ::.:..|.|.|    .:||..|:....|       ||..
  Fly   142 PNDATVD-----ISGWGAISQRGP--ISNSLLYVQVK----ALSRESCQKTYLR-------QLPE 188

  Fly   257 TILCAGGERGRDACIGDGGSPLMCPIPGHPAIYE--LVGIVNSGF-SCGLENVPALYTNISHMRP 318
            |.:|....:.:.||.||.|.         ||.|:  |||:.:... .|| ...|..|..:|.:|.
  Fly   189 TTMCLLHPKDKGACYGDSGG---------PATYQGKLVGLASFVIGGCG-RAAPDGYERVSKLRN 243

  Fly   319 WIEKQ 323
            ||.::
  Fly   244 WIAEK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 62/251 (25%)
Tryp_SPc 90..320 CDD:214473 60/246 (24%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 63/259 (24%)
Tryp_SPc 28..248 CDD:238113 65/261 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457629
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.