DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG33160

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:256 Identity:73/256 - (28%)
Similarity:115/256 - (44%) Gaps:44/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGG 140
            |..:||.|..:    |..::...|...:.|.    .|:||....||||||.:.:|..|||.|.||
  Fly    32 PRIIGGHVSSI----KEEKYLVQVTTSEELC----GGSLVKPRWVITAAHCVYNKNKNDFKIYGG 88

  Fly   141 AWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSF----VMKPPIGPICWPTSGVS 201
            |   ...||.....||...|...||||:.|...::|.:.|.:..    :...|:.....|.    
  Fly    89 A---SNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPA---- 146

  Fly   202 FDRERCLVAGWGRPDFLAKNYSYKQKKID---LPIVSRSDCESLLRRTAFVQSFQLDPTILCAGG 263
              |....|:|||   ||..:.:...:::.   :|:.||:.|.|     ||....::..:::||..
  Fly   147 --RALVKVSGWG---FLTADATKTAERVHSVLVPMWSRASCVS-----AFRGIHRITRSMVCAAR 201

  Fly   264 ERGRDACIGDGGSPLMCPIPGHPAIY--ELVGIVNSGFSCGLENVPALYTNISHMRPWIEK 322
            ...:|:|.||.|.||         :|  :|.|||:.|:.|. ..:|.:||::..:|.|.::
  Fly   202 LYKKDSCDGDSGGPL---------VYRGQLAGIVSFGYGCA-SALPGIYTSVPEIRDWFQR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 69/244 (28%)
Tryp_SPc 90..320 CDD:214473 68/238 (29%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 71/250 (28%)
Tryp_SPc 34..253 CDD:238113 72/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.