DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG31827

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:264 Identity:108/264 - (40%)
Similarity:150/264 - (56%) Gaps:2/264 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTIN 133
            |.||..||:.:.........||||.|||||:|::.|. :..|.|:|:|.:||:||||.:.:|.:.
  Fly    29 LKCGYGNPDAVKVQFNVTEGQAKPAEFPWTIAVIHNR-SLVGGGSLITPDIVLTAAHRIFNKDVE 92

  Fly   134 DFGIIGGAWDLKQLAGK-TIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPT 197
            |..:..|.|:......| ..:.....::|.|..||...||||:||:.|:..|.:...|..||.||
  Fly    93 DIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPT 157

  Fly   198 SGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAG 262
            ...|....||:|||||:..|...:|....||||||||.|..|:..||:|...|::.|...::|||
  Fly   158 QKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAG 222

  Fly   263 GERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLNDE 327
            ||:..|||.||||..|.||:...|..:|.:||||.|..|..:||||.||::...:|||.:|:.:.
  Fly   223 GEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQIKEN 287

  Fly   328 LNKP 331
            |..|
  Fly   288 LYTP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 100/235 (43%)
Tryp_SPc 90..320 CDD:214473 97/230 (42%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 99/233 (42%)
Tryp_SPc 50..280 CDD:214473 97/230 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471512
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.