DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG31780

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster


Alignment Length:321 Identity:121/321 - (37%)
Similarity:170/321 - (52%) Gaps:21/321 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ETGAPCGLQME--CVPQGLCKTSAWNQNAISWPS-PCQRSESCCHSS-----QKLVIGAPL---N 70
            |....||...|  |||:.:||.....:.|:::.: .|..:..||..:     .:|:|..|:   .
  Fly    28 ELNQSCGASNEHQCVPRHMCKVKIEFRMAMTYRNLGCVSTAICCPKNLIIKEPRLIINEPITDPQ 92

  Fly    71 CGKSNPNGLGGTV-EEVVDQAKPNEFPWTVALMQ-NLINFFGAGTLVTENIVITAAHLMLDKTIN 133
            ||..|..|:..:. ||....|:..|.||.|||:. ...::...|.|:..::||||.....:.|.:
  Fly    93 CGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTAS 157

  Fly   134 DFGIIGGAWDL----KQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPIC 194
            ...:..|.||.    :||....:..|:   ||.||.||...||||:||:.|..|......|.|||
  Fly   158 QLVVRAGEWDFSTKTEQLPSVDVPIRS---IVRHPGFNLENGANNVALVFLRRSLTSSRHINPIC 219

  Fly   195 WPTSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTIL 259
            .|::..:||..||:..|||:..|...:|....|||.||:|.|..||..| |..:...|:||.:::
  Fly   220 MPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQL-RLYYGNDFELDNSLM 283

  Fly   260 CAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWI 320
            |||||.|:|:|.|||||||.|.|..:|..|||.||||.|..|||..|||:|||::::..||
  Fly   284 CAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 99/238 (42%)
Tryp_SPc 90..320 CDD:214473 97/234 (41%)
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 97/234 (41%)
Tryp_SPc 113..344 CDD:238113 97/234 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471550
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.