DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG32808

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:270 Identity:73/270 - (27%)
Similarity:113/270 - (41%) Gaps:41/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LNCGKSNPNG--LGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAG-TLVTENIVITAAHLMLDK 130
            |..|.|..:|  :.||.      |.|.|||:.|:|.:........| ||:....|:||||.:...
  Fly    19 LLAGASGEDGKIVNGTT------AGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGS 77

  Fly   131 TINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFN-KMTGANNIALIVLETSFVMKPPIGPIC 194
            :.....:..|:   :.||..:.|......|..||.:. :....|:|||:.|..|..:...:.|:.
  Fly    78 SPEQLDLQYGS---QMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVR 139

  Fly   195 WP-----TSGVSFDRERCLVAGWGRPDFLAKNYSYKQ--KKIDLPIVSRSDCESLLRRTAFVQSF 252
            .|     |.|    ....::||||   ..|.....:|  :|:.|.:.|.::|..  |...::...
  Fly   140 LPEPRQVTPG----NASAVLAGWG---LNATGGVVQQHLQKVKLQVFSDTECSE--RHQTYLHDS 195

  Fly   253 QLDPTILCAG-GERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFS-CGLENVPALYTNISH 315
            |     :||| .|.|:..|.||.|.||:  :.|...   .||||:.... |.....|.::|.:|.
  Fly   196 Q-----ICAGLPEGGKGQCSGDSGGPLL--LIGSDT---QVGIVSWSIKPCARPPFPGVFTEVSA 250

  Fly   316 MRPWIEKQLN 325
            ...||.:.:|
  Fly   251 YVDWIVETVN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 66/245 (27%)
Tryp_SPc 90..320 CDD:214473 64/240 (27%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 66/253 (26%)
Tryp_SPc 30..258 CDD:238113 68/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.