DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG32755

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:295 Identity:78/295 - (26%)
Similarity:132/295 - (44%) Gaps:67/295 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PNGLGG---TVEEVVDQAKPNEFPWTVALMQNLIN--FFG-----AGTLVTENIVITAAHLMLDK 130
            |..:||   |:::|         |:.|::.:..|:  .:|     .|.::::.:|.:|||.....
  Fly    36 PKIVGGYTVTIDQV---------PFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAIN 91

  Fly   131 T-----IND---FGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMK 187
            |     ..|   :.::.|:..:.: ..:..|.....|||.|.|:|..|..|:|||:.|.      
  Fly    92 TSVPLVYRDPELYVVVAGSSAIDR-TDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLN------ 149

  Fly   188 PPIGPICWPTSGVSF---------DRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLL 243
               |.|.|.:.||..         :...||:.|||:.....|:.|.:|..:  ||:::..|:.: 
  Fly   150 ---GFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPV--PILNKELCQVI- 208

  Fly   244 RRTAFVQSFQLDPTILCAGG-ERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVP 307
                    ::|..:.:|||. :.|.|||.||.|.||:|.       ..|.||::.|..|.....|
  Fly   209 --------YKLPASQMCAGFLQGGIDACQGDSGGPLICD-------GRLAGIISWGVGCADPGYP 258

  Fly   308 ALYTNISHMRPWIEKQLNDELN-KPYKTFPIYNIS 341
            .:|||:||...|| ::.|..|: ..|:..|..|::
  Fly   259 GVYTNVSHFLKWI-RRANASLDYSEYRQIPPLNLA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 68/259 (26%)
Tryp_SPc 90..320 CDD:214473 66/254 (26%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 70/270 (26%)
Tryp_SPc 38..273 CDD:238113 72/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.