DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG6041

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:293 Identity:79/293 - (26%)
Similarity:130/293 - (44%) Gaps:64/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GKSNPNGLGG---TVEEVVDQAKPNEFPWTVALMQNLINFFGAGTL-----VTENIVITAAH--L 126
            ||..|..:||   ::|:|..|.       ::.|..|....:|:|.|     :::.:|.||||  .
  Fly    29 GKIEPKIVGGYDASIEQVSYQV-------SIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCY 86

  Fly   127 MLDK----TINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMK 187
            :.||    |..:|.::.|:..|.....:|:.: ...::::|.::|.....|:|||:.: ..::  
  Fly    87 ITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMY-YLQQLITHENYNPDALTNDIALMFI-NGYI-- 147

  Fly   188 PPIGPICWPT-------SGVSFDRERCLVAGWGRPDFLAKNYSYKQKKID---LPIVSRSDCESL 242
                |..|||       |.:......||::|||   .|.:|.::....:.   :||||.:.|.  
  Fly   148 ----PWNWPTVTALALNSQLVATNTDCLISGWG---LLQQNGTFSSNTLQAATVPIVSYTTCR-- 203

  Fly   243 LRRTAFVQSFQLDPTILCAGG-ERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENV 306
                  :....:..:.:|||. ..|.|||.||.|.|:.|.       ..|.|||:.|..|.....
  Fly   204 ------ISYNSIPVSQVCAGYLSGGVDACQGDSGGPMSCN-------GMLAGIVSYGAGCAAPGY 255

  Fly   307 PALYTNISHMRPWIEKQLNDELNKPYKTFPIYN 339
            |.:|||:|:...|| .|.|..||     :.||:
  Fly   256 PGVYTNVSYYYDWI-VQKNSSLN-----YTIYH 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 66/256 (26%)
Tryp_SPc 90..320 CDD:214473 63/251 (25%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 68/267 (25%)
Tryp_SPc 35..272 CDD:238113 70/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.