DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Prss30

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:288 Identity:78/288 - (27%)
Similarity:122/288 - (42%) Gaps:51/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PLNCGKSNPNG--LGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLM--- 127
            |..||.|...|  :||      ..|...::||.|:|..........|:|:.|..|:||||..   
Mouse    62 PSVCGHSRDAGKIVGG------QDALEGQWPWQVSLWITEDGHICGGSLIHEVWVLTAAHCFRRS 120

  Fly   128 LDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDF---NKMTGANNIALIVLETSFVMKP- 188
            |:.:.....:.|....|.:.....:..|   .|..||.:   :..:|  :|||:.|:|.  ::| 
Mouse   121 LNPSFYHVKVGGLTLSLLEPHSTLVAVR---NIFVHPTYLWADASSG--DIALVQLDTP--LRPS 178

  Fly   189 PIGPICWP------TSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCE------- 240
            ...|:|.|      |.|..     |.|.|||...  .::.:...:::.:|::...|||       
Mouse   179 QFTPVCLPAAQTPLTPGTV-----CWVTGWGATQ--ERDMASVLQELAVPLLDSEDCEKMYHTQG 236

  Fly   241 SLLRRTAFVQSFQLDPTILCAGGERG-RDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLE 304
            |.|.....:||     .:||||...| :|:|.||.|.||:|.|   .:.:..|||.:.|..|...
Mouse   237 SSLSGERIIQS-----DMLCAGYVEGQKDSCQGDSGGPLVCSI---NSSWTQVGITSWGIGCARP 293

  Fly   305 NVPALYTNISHMRPWIEKQLNDELNKPY 332
            ..|.:||.:.....||::.|.:..:..|
Mouse   294 YRPGVYTRVPTYVDWIQRILAENHSDAY 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 69/255 (27%)
Tryp_SPc 90..320 CDD:214473 67/250 (27%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 71/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.