DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Tmprss13

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001121000.1 Gene:Tmprss13 / 300682 RGDID:1310872 Length:539 Species:Rattus norvegicus


Alignment Length:289 Identity:76/289 - (26%)
Similarity:128/289 - (44%) Gaps:38/289 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PSPCQRSESCCHSSQKLVIGAPLNCGKSNPNG--LGGTVEEVVDQAKPNEFPWTVALMQNLINFF 109
            ||....|..|.|            ||.....|  :||.:      ...:::||.|:|.....:..
  Rat   277 PSRRYVSLQCAH------------CGLRAMTGRIVGGAL------TSESKWPWQVSLHFGTTHIC 323

  Fly   110 GAGTLVTENIVITAAHLML---DKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTG 171
            | |||:....|:||||...   :|.:..:.:..|..:|.||.    :..:.::|:.:.::.....
  Rat   324 G-GTLIDAQWVLTAAHCFFVTREKILEGWKVYAGTSNLHQLP----EAASISQIIINGNYTDEQD 383

  Fly   172 ANNIALIVLETSFVMKPPIGPICWPTSGVSFD-RERCLVAGWGRPDFLAKNYSYKQKKIDLPIVS 235
            ..:|||:.|.....:...|.|.|.|..|.:|. .|.|.:.|:|:.....:..|...:::.:.::.
  Rat   384 DYDIALVRLSKPLTLSAHIHPACLPLHGQTFGLNETCWITGFGKTKETDEKTSPFLREVQVNLID 448

  Fly   236 RSDCESLLRRTAFVQSFQLDPTILCAGGER-GRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGF 299
            ...|...|     |....|.|.::|||..| |||:|.||.|.||:|.....   :.|.|:.:.|.
  Rat   449 FKKCNDYL-----VYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCEQNNR---WYLAGVTSWGT 505

  Fly   300 SCGLENVPALYTNISHMRPWIEKQLNDEL 328
            .||.:|.|.:||.::.:.|||.:::..|:
  Rat   506 GCGQKNKPGVYTKVTEVLPWIYRKMESEV 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 65/239 (27%)
Tryp_SPc 90..320 CDD:214473 63/234 (27%)
Tmprss13NP_001121000.1 WWbp <1..69 CDD:304964
SRCR_2 203..292 CDD:292133 7/26 (27%)
SRCR 216..288 CDD:278931 4/10 (40%)
Tryp_SPc 297..526 CDD:214473 65/247 (26%)
Tryp_SPc 298..526 CDD:238113 65/246 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.