DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Tpsb2

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:280 Identity:83/280 - (29%)
Similarity:120/280 - (42%) Gaps:47/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LVIGAPLNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNL---INFFGAGTLVTENIVITAA 124
            ||..||  |......|:.|..|     |..:::||.|:|....   ::|.| |:|:....|:|||
  Rat    16 LVHAAP--CPVKQRVGIVGGRE-----ASESKWPWQVSLRFKFSFWMHFCG-GSLIHPQWVLTAA 72

  Fly   125 HL--MLDKTINDFGIIGGAWDLKQLAGKTI----QWRTATRIVSHPDFNKMTGANNIALIVLETS 183
            |.  :..|:...|.:        ||..:.:    |..|..|.|.||.:..:....:|||:.||..
  Rat    73 HCVGLHIKSPELFRV--------QLREQYLYYADQLLTVNRTVVHPHYYTVEDGADIALLELENP 129

  Fly   184 FVMKPPIGPICWPTSGVSF-DRERCLVAGWGRPDF---LAKNYSYKQKKIDLPIVSRSDCESLLR 244
            ..:...|.|...|.:..:| ....|.|.|||..|.   |...|..||.|:  |||..|.|:....
  Rat   130 VNVSTHIHPTSLPPASETFPSGTSCWVTGWGDIDSDEPLLPPYPLKQVKV--PIVENSLCDRKYH 192

  Fly   245 RTAF-------VQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCG 302
            ...:       ||.     .:||||..|. |:|.||.|.||:|.:.|   .:...|:|:.|..|.
  Rat   193 TGLYTGDDVPIVQD-----GMLCAGNTRS-DSCQGDSGGPLVCKVKG---TWLQAGVVSWGEGCA 248

  Fly   303 LENVPALYTNISHMRPWIEK 322
            ..|.|.:||.:::...||.:
  Rat   249 EANRPGIYTRVTYYLDWIHR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 75/255 (29%)
Tryp_SPc 90..320 CDD:214473 73/249 (29%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 77/262 (29%)
Tryp_SPc 30..266 CDD:214473 75/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346384
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.