DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Prss38

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:347 Identity:87/347 - (25%)
Similarity:148/347 - (42%) Gaps:61/347 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TETGAPCGLQMECVPQGLCKTSAWNQNAISWPSPCQRSESC-----------CHSSQKLVIGAPL 69
            ::.|.|....:...|..|..|||.:..    |:|...:..|           |.....|.:....
  Rat    43 SDVGRPLSQGLGSDPFSLDGTSALSPG----PAPPHSNIRCPFLHPWPPLLWCGREPSLHLFLSS 103

  Fly    70 NCGKSNPNG--LGGTVEEVVDQAKPNEFPWTVALMQNLINFFG----AGTLVTENIVITAAHLML 128
            .||:...:|  |||  |..:|:    ::||.|:     |::.|    .|:::....|:||||...
  Rat   104 ACGQPALHGKLLGG--ELTIDR----KWPWQVS-----IHYAGFHVCGGSILNAYWVLTAAHCFA 157

  Fly   129 -DKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKM-TGANNIALIVLETSFVMKPPIG 191
             :|.:..|.:..|..:| ::|.|..||....:::.||.|... ....::||:..:::.|....:.
  Rat   158 REKRLQTFDMYVGITNL-EVANKHTQWFEINQVIIHPTFEMFHPVGGDVALVQSKSAIVFSDYVL 221

  Fly   192 PICWPTSGVSFDRERCLVAGWGR--------PDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAF 248
            |||.|:|.::.....|...|||.        .|.|         :..||::.:..|:.|...|::
  Rat   222 PICLPSSNLNLSDLSCWTTGWGMVSPQGETGKDLL---------EAQLPLIPKFQCQLLYGLTSY 277

  Fly   249 VQSFQLDPTILCAGGERG-RDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTN 312
                 |.|.:||||..:. ::.|.||.||||:|.:   ...:..:|||:.|..|.....|.::.|
  Rat   278 -----LLPEMLCAGDIKNMKNVCEGDSGSPLVCKV---NQTWLQIGIVSWGRGCAQPLYPGVFAN 334

  Fly   313 ISHMRPWIEKQLNDELNKPYKT 334
            :|:...||...:....:.|..|
  Rat   335 VSYFLNWIRYNMETIPDPPQLT 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 66/249 (27%)
Tryp_SPc 90..320 CDD:214473 63/244 (26%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 68/255 (27%)
Tryp_SPc 116..342 CDD:214473 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.