DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Prss34

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:297 Identity:76/297 - (25%)
Similarity:118/297 - (39%) Gaps:92/297 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LGGTVEEVVDQAK------------PNEFPWTVALMQNLINFFG----------AGTLVTENIVI 121
            ||.|:....|..:            .:.|||.|:|     .|:.          .|:|:....|:
  Rat    16 LGSTMPLTPDSGQELVGIVGGCPVSASRFPWQVSL-----RFYNMKLSKWEHICGGSLIHPQWVL 75

  Fly   122 TAAHLMLDKTINDFGIIGGAWDLKQLAGKTI-------------QWRTATRIVSHPDFNK---MT 170
            ||||.:               :||::.....             |.....:|:.||.|::   ..
  Rat    76 TAAHCV---------------ELKEMEASCFRVQVGQLRLYENDQLMKVAKIIRHPKFSEKLSAP 125

  Fly   171 GANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERC-LVAGWG---------RPDFLAKNYSYK 225
            |..:|||:.|:::.|:...:.|:..|.:......::. .|||||         .|..|       
  Rat   126 GGADIALLKLDSTVVLSERVHPVSLPAASQRISSKKTWWVAGWGVIEGHRPLPPPCHL------- 183

  Fly   226 QKKIDLPIVSRSDCE-------SLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIP 283
             :::.:|||..||||       ||.|.|..::.     .:||||.| |||:|..|.|.||:|   
  Rat   184 -REVAVPIVGNSDCEQKYRTYSSLDRTTKIIKD-----DMLCAGME-GRDSCQADSGGPLVC--- 238

  Fly   284 GHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWI 320
            .....:..||:|:.|..|||.:.|.:||.:.....||
  Rat   239 RWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 73/288 (25%)
Tryp_SPc 90..320 CDD:214473 70/284 (25%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 72/280 (26%)
Tryp_SPc 33..275 CDD:214473 70/278 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.