DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Prss29

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:276 Identity:74/276 - (26%)
Similarity:127/276 - (46%) Gaps:47/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GLGGTVEEVV-------DQAKPNEFPWTVALMQNLINFFG-----AGTLVTENIVITAAHLMLDK 130
            |:..:|.|.|       :.|...::||.|:|.....|:..     .|:::....|:||||.:.:.
  Rat    18 GIPASVPEDVLVGIVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHES 82

  Fly   131 T---------INDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVM 186
            .         :....:.||...||           .:|::.||||.:....:::||:.|..|...
  Rat    83 DADPSAFRIYLGQVYLYGGEKLLK-----------VSRVIIHPDFVRSGLGSDVALLQLAQSVRS 136

  Fly   187 KPPIGPI-CWPTSGVSFDRERCLVAGWGRPDFLAKNYS----YKQKKIDLPIVSRSDCESLLRRT 246
            .|.:.|: ..|.|.....::.|.|.|||.   ::.:.|    |:.:::.:.||..:.||.|.|..
  Rat   137 FPNVKPVKLSPASLEVTKKDVCWVTGWGS---VSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNA 198

  Fly   247 AFVQSF---QLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPA 308
            ..:.:.   .:...:||| |..|||:|.||.|.||:|.:.|.   :.|||:|:.|:.|.|:::|.
  Rat   199 TRLSNHGQRLILQDMLCA-GSHGRDSCYGDSGGPLVCNVTGS---WTLVGVVSWGYGCALKDIPG 259

  Fly   309 LYTNISHMRPWIEKQL 324
            :|..:....|||..|:
  Rat   260 VYARVQFFLPWITGQM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 69/256 (27%)
Tryp_SPc 90..320 CDD:214473 67/251 (27%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.