DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Prss30

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:293 Identity:73/293 - (24%)
Similarity:121/293 - (41%) Gaps:57/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 HSSQKLVIGAPLNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVIT 122
            ||....::|     |:..|.|               .:||.|:|..........|:|:.|..|:|
  Rat    25 HSGAGKIVG-----GQDAPEG---------------RWPWQVSLRTEKEGHICGGSLIHEVWVLT 69

  Fly   123 AAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWR------TATR-IVSHPDFN-KMTGANNIALIV 179
            |||.......:.|..:       ::.|.|:...      .|.| |..:|.:. :...:.:|||:.
  Rat    70 AAHCFCRPLNSSFYHV-------KVGGLTLSLTEPHSTLVAVRNIFVYPTYLWEDASSGDIALLR 127

  Fly   180 LETSFVMKP-PIGPICWP------TSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRS 237
            |:|.  ::| ...|:|.|      |.|..     |.|.|||...  .:..:...:::.:|::...
  Rat   128 LDTP--LQPSQFSPVCLPQAQAPLTPGTV-----CWVTGWGATH--ERELASVLQELAVPLLDSE 183

  Fly   238 DCESL--LRRTAFVQSFQLDPTILCAGGERG-RDACIGDGGSPLMCPIPGHPAIYELVGIVNSGF 299
            |||.:  :..|:......:...:||||...| :|:|.||.|.||:|.|   .:.:..|||.:.|.
  Rat   184 DCERMYHIGETSLSGKRVIQSDMLCAGFVEGQKDSCQGDSGGPLVCAI---NSSWIQVGITSWGI 245

  Fly   300 SCGLENVPALYTNISHMRPWIEKQLNDELNKPY 332
            .|...|.|.:||.:.....||::.|.:..:..|
  Rat   246 GCARPNKPGVYTRVPDYVDWIQRTLAENHSDAY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 65/252 (26%)
Tryp_SPc 90..320 CDD:214473 63/247 (26%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.