DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Prss3b

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:263 Identity:70/263 - (26%)
Similarity:114/263 - (43%) Gaps:49/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LGGTVEEVVDQ----------AKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTIN 133
            ||..|...:|.          .:.|..|:.|:|  |....|..|:|:....|::|||....:...
  Rat    10 LGAAVALPLDDDDDKIVGGYTCQKNSLPYQVSL--NAGYHFCGGSLINSQWVVSAAHCYKSRIQV 72

  Fly   134 DFG------IIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGP 192
            ..|      :.||.           |:..|.:|:.||.:|..|..|:|.||.|.:...:...:..
  Rat    73 RLGEHNIDVVEGGE-----------QFIDAAKIIRHPSYNANTFDNDIMLIKLNSPATLNSRVST 126

  Fly   193 ICWPTSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSF--QLD 255
            :..|.|..| ...:|||:|||.......||....:.:|.|::|.|.|:|         |:  ::.
  Rat   127 VSLPRSCGS-SGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKS---------SYPGKIT 181

  Fly   256 PTILCAGG-ERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPW 319
            ..:.|.|. |.|:|:|.||.|.|::|.       .:|.|:|:.|:.|..:..|.:||.:.:...|
  Rat   182 SNMFCLGFLEGGKDSCQGDSGGPVVCN-------GQLQGVVSWGYGCAQKGKPGVYTKVCNYVNW 239

  Fly   320 IEK 322
            |::
  Rat   240 IQQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 67/254 (26%)
Tryp_SPc 90..320 CDD:214473 64/238 (27%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 64/245 (26%)
Tryp_SPc 25..243 CDD:238113 66/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.