DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG33225

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:290 Identity:79/290 - (27%)
Similarity:122/290 - (42%) Gaps:51/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LVIGAPLNCGKSNPNGLGGT-----VEEVVDQAKPNEF--PWTVALM-QNLINFFGAGTLVTENI 119
            ||:||.|.......|..|.|     :..||.....:.|  ||.|.:: :|  |.|.:|:|:|...
  Fly    29 LVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGEN--NVFCSGSLITRLF 91

  Fly   120 VITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRI---VSHPDFNKMTGAN-NIALIVL 180
            |:|:|..:|.....   :|.|.:|....:......|....|   :.|..|...|... :|||:.|
  Fly    92 VLTSASCLLSLPKQ---VILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRL 153

  Fly   181 ETSFVMKPPIGPICWPTSGVSFDR------ERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDC 239
            .....:...:.|||     :|.||      :.....|||..::  ...|...:.:.|..::|..|
  Fly   154 AKKVSISDYVRPIC-----LSVDRQVGRSVQHFTATGWGTTEW--NEPSTILQTVTLSKINRKYC 211

  Fly   240 ESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIP-------GHPAIYELVGIVNS 297
            :..||:       .:|.:.||.||.| :|.|.||.|.||...:.       .:.:...|:|||:.
  Fly   212 KGRLRQ-------NIDASQLCVGGPR-KDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSY 268

  Fly   298 G-FSC-GLENVPALYTNISHMRPWIEKQLN 325
            | .|| |:    .:|||:.|...||.:.:|
  Fly   269 GSSSCSGI----GVYTNVEHYMDWIVRTIN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 68/256 (27%)
Tryp_SPc 90..320 CDD:214473 66/251 (26%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 68/256 (27%)
Tryp_SPc 57..292 CDD:238113 70/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.