DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Tpsg1

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:323 Identity:79/323 - (24%)
Similarity:136/323 - (42%) Gaps:61/323 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GLQMECVPQGLCKTSAWNQNAISWPSPCQRS---ESCCHSSQKLVIGAPLNCGKSNPNGLGGTVE 84
            |||    ..||.::..|   |.|.|:...|.   :|..:|     :.:...||....:..|..: 
Mouse    36 GLQ----GPGLAESFQW---ATSKPTVSARGQYPDSLANS-----VSSGSGCGHPQVSNSGSRI- 87

  Fly    85 EVVDQAKP-NEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTIN--DFGIIGGAWDLKQ 146
             |...|.| ..:||..:|..:.::..| |:|::...|:|||| ....::|  |:.:        .
Mouse    88 -VGGHAAPAGTWPWQASLRLHKVHVCG-GSLLSPEWVLTAAH-CFSGSVNSSDYQV--------H 141

  Fly   147 LAGKTI----QWRTATRIVSHPDFNKMTGAN-NIALIVLETSFVMKPPIGPICWPTSGVSF-DRE 205
            |...|:    .:.|..||:.:.......|:: :|||:.|.:...:...:.|:|.|.:...| ...
Mouse   142 LGELTVTLSPHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLPEASADFYPGM 206

  Fly   206 RCLVAGW---GRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQ------LDPTILCA 261
            :|.|.||   |..:.|...|:.::.|:.  :|....|.         |::.      :.|.:|||
Mouse   207 QCWVTGWGYTGEGEPLKPPYNLQEAKVS--VVDVKTCS---------QAYNSPNGSLIQPDMLCA 260

  Fly   262 GGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQL 324
            .|.  .|||..|.|.||:|.:.|   .::..|:|:.|..||..:.|.:|..::....||...:
Mouse   261 RGP--GDACQDDSGGPLVCQVAG---TWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHHHI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 63/252 (25%)
Tryp_SPc 90..320 CDD:214473 61/247 (25%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 64/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.