DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Plau

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_037217.3 Gene:Plau / 25619 RGDID:3343 Length:432 Species:Rattus norvegicus


Alignment Length:373 Identity:90/373 - (24%)
Similarity:150/373 - (40%) Gaps:100/373 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QGLCKTSAWNQNAISWPSPCQRSESC-CHSSQKLVIGAPLNCGKSNPN-----------GLGGTV 83
            :|...|....:..::|.||....::. .|.|..|.:|...:....||:           ||...|
  Rat    79 RGKANTDTKGRPCLAWNSPAVLQQTYNAHRSDALSLGLGKHNYCRNPDNQRRPWCYVQIGLKQFV 143

  Fly    84 EEVVDQ-----AKPN------------------------EF------PWTVAL-MQNL----INF 108
            :|.:.|     .||:                        ||      ||..|: ::|.    .:|
  Rat   144 QECMVQDCSLSKKPSSTVDQQGFQCGQKALRPRFKIVGGEFTVVENQPWFAAIYLKNKGGSPPSF 208

  Fly   109 FGAGTLVTENIVITAAHLMLDKTINDFGII--GGA-----------WDLKQLAGKTIQWRTATRI 160
            ...|:|::...|.:|.|..:::...:..::  |.:           ::::||             
  Rat   209 KCGGSLISPCWVASATHCFVNQPKKEEYVVYLGQSKRNSYNPGEMKFEVEQL------------- 260

  Fly   161 VSHPDFNKMTGA--NNIALIVLETSF--VMKP--PIGPICWPT--SGVSFDRERCLVAGWGRPDF 217
            :.|.||:..|.|  |:|||:.:.||.  ..:|  .|..||.|.  ....|..: |.:.|:|:.. 
  Rat   261 ILHEDFSDETLAFHNDIALLKIRTSTGQCAQPSRTIQTICLPPRFGDAPFGSD-CEITGFGQES- 323

  Fly   218 LAKNYSY-KQKKID-LPIVSRSDCESLLRRTAFVQSFQLDPTILCAGG-ERGRDACIGDGGSPLM 279
             |.:|.| |..|:. :.|:|...|     :.......:::..:|||.. |...|:|.||.|.||:
  Rat   324 -ATDYFYPKDLKMSVVKIISHEQC-----KQPHYYGSEINYKMLCAADPEWKTDSCSGDSGGPLI 382

  Fly   280 CPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLNDE 327
            |.|.|.|.   |.|||:.|..|..:|.|.:||.:|:...||:..:.:|
  Rat   383 CNIDGRPT---LSGIVSWGSGCAEKNKPGVYTRVSYFLNWIQSHIGEE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 74/298 (25%)
Tryp_SPc 90..320 CDD:214473 71/288 (25%)
PlauNP_037217.3 Binds urokinase plasminogen activator surface receptor 34..57
KR 67..152 CDD:238056 16/72 (22%)
Connecting peptide 152..178 2/25 (8%)
Tryp_SPc 178..420 CDD:214473 69/265 (26%)
Tryp_SPc 179..423 CDD:238113 71/267 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.