DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and F9

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_113728.1 Gene:F9 / 24946 RGDID:2589 Length:462 Species:Rattus norvegicus


Alignment Length:369 Identity:89/369 - (24%)
Similarity:146/369 - (39%) Gaps:92/369 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GAPCGLQMEC-VPQGLCKTSAWN--QNAI-------------------SWPSPCQRSESCCHSSQ 61
            |..|.|...| :..|.||....|  .|.|                   :.|.||.| .|..::|:
  Rat   118 GRNCELDATCSIKNGRCKQFCKNSPDNKIICSCTEGYQLAEDQKSCEPAVPFPCGR-VSVAYNSK 181

  Fly    62 KLVIGAPLNCGKSNPNGLGGTVEEVVD----------------------------QAKPNEFPWT 98
            |:.....:   .||.: .|.:.|.::|                            .|||.:.||.
  Rat   182 KITRAETV---FSNTD-YGNSTELILDDITNSTILDNLTENSEPINDFTRVVGGENAKPGQIPWQ 242

  Fly    99 VALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSH 163
            | ::...|..|..|.::.|..::||||.:  |..:...::.|..::.: ...|.|.|...|.:.|
  Rat   243 V-ILNGEIEAFCGGAIINEKWIVTAAHCL--KPGDKIEVVAGEHNIDE-KEDTEQRRNVIRTIPH 303

  Fly   164 PDFNKMTG--ANNIALIVLETSFVMKPPIGPICWPT-----------SGVSFDRERCLVAGWGRP 215
            ..:|....  :::|||:.|:...::...:.|||...           ||        .|:|||:.
  Rat   304 HQYNATINKYSHDIALLELDKPLILNSYVTPICVANKEYTNIFLKFGSG--------YVSGWGKV 360

  Fly   216 DFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAG-GERGRDACIGDGGSPLM 279
            ....:..|..| .:.:|:|.|:.|   ||.|    .|.:...:.||| .|.|:|:|.||.|.|.:
  Rat   361 FNKGRQASILQ-YLRVPLVDRATC---LRST----KFSIYNNMFCAGYREGGKDSCEGDSGGPHV 417

  Fly   280 CPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQ 323
            ..:.|...   |.||::.|..|.::....:||.:|....||:::
  Rat   418 TEVEGTSF---LTGIISWGEECAMKGKYGIYTKVSRYVNWIKEK 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 68/276 (25%)
Tryp_SPc 90..320 CDD:214473 65/243 (27%)
F9NP_113728.1 GLA 21..85 CDD:214503
EGF_CA 86..122 CDD:238011 1/3 (33%)
FXa_inhibition 127..163 CDD:291342 7/35 (20%)
Tryp_SPc 227..455 CDD:214473 65/250 (26%)
Tryp_SPc 228..458 CDD:238113 67/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.