DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG30289

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:268 Identity:69/268 - (25%)
Similarity:103/268 - (38%) Gaps:42/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NCGKSN-----PNGLGGTVEEVVDQAKPN--EFPWTVALMQNLINFFGAGTLVTENIVITAAHLM 127
            |||.|.     ||..||        ||.|  |.||.|.:..:..   ..|:|:....|:||||.:
  Fly    29 NCGISKDDPYVPNIFGG--------AKTNIQENPWMVLVWSSKP---CGGSLIARQFVLTAAHCV 82

  Fly   128 LDKTINDFGIIGGAWDL---------KQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETS 183
               :..|..:..|.::.         .....|........:|| |.::|.:|..|:|||:.:..:
  Fly    83 ---SFEDLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIV-HENYNGITLQNDIALLRMSEA 143

  Fly   184 FVMKPPIGPICWPTSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAF 248
            ......:.|||..............|.|||..::  ..:|.......|..:..|.|.....:   
  Fly   144 VEYSDYVRPICLLVGEQMQSIPMFTVTGWGETEY--GQFSRILLNATLYNMDISYCNIKFNK--- 203

  Fly   249 VQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIP-GHPAIYELVGIVNSGFSCGLENVPALYTN 312
                |.|.:.:|||.... :.|.||.|.||..... |:..:....|:|:.|......||..:|||
  Fly   204 ----QADRSQICAGSHTS-NTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTN 263

  Fly   313 ISHMRPWI 320
            :|:.|.||
  Fly   264 VSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 61/245 (25%)
Tryp_SPc 90..320 CDD:214473 59/241 (24%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 61/253 (24%)
Tryp_SPc 42..271 CDD:238113 61/253 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.