DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG30288

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:295 Identity:68/295 - (23%)
Similarity:109/295 - (36%) Gaps:98/295 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTIND 134
            :||.::.||....::...|....:. ||.|.:|.:.....| |:|:|...|:||.|.:....:| 
  Fly    30 DCGTTSSNGYRARIDGGRDAGMESN-PWMVRVMISGKAVCG-GSLITARFVLTAEHCISPMYMN- 91

  Fly   135 FGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFN-----------------KMTGAN---NIALIV 179
              :..|.:|.:                 ||.|:                 |:..:|   :|.|:.
  Fly    92 --VRLGEYDTR-----------------HPIFDCDDFVCTPRAYNVDVDRKIVHSNPGYDIGLLR 137

  Fly   180 LETSFVMKPPIGPICW---------PTSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVS 235
            ::.|.:....:.|||.         |.|.:.|:     ..|||                     :
  Fly   138 MQRSVIFSNYVRPICLILGKTLGGNPLSILRFN-----FTGWG---------------------T 176

  Fly   236 RSDCESLLR-RTAFVQSF----------QLDPTILCAGGERGRDACIGDGGSPLMC--PIPGHPA 287
            .||.|...| :||.:|..          .||.:.:|||.... |:|.||.|.||..  ...|...
  Fly   177 NSDGEEQDRLQTATLQQLPQWSCERPGRPLDISYICAGSYIS-DSCKGDSGGPLSAIRTFEGQGR 240

  Fly   288 IYELVGIVNSGFS-C-GLENVPALYTNISHMRPWI 320
            :::. |:.:.|.. | ||    .:|||::|...||
  Fly   241 VFQF-GVASQGLRLCSGL----GIYTNVTHFTDWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 64/277 (23%)
Tryp_SPc 90..320 CDD:214473 61/273 (22%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 62/281 (22%)
Tryp_SPc 45..270 CDD:238113 62/278 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.