DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG30287

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:264 Identity:75/264 - (28%)
Similarity:112/264 - (42%) Gaps:56/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VDQAKPNEF---PWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLA 148
            |...||.:.   ||.|.:::..:...| |:|:|...|:||||.. .:|.:...:..|.:|:.|..
  Fly    42 VINGKPADLFSNPWMVIIIERGMMKCG-GSLITPRYVLTAAHCK-SETKSQLTVRLGDYDVNQAV 104

  Fly   149 -----GKTIQWR----TATRIVSH-PDFNKMTGANNIALIVLETSFVMKPPIGPIC-------WP 196
                 |...:.|    |.|.:.|| .:|.|    |:|||:.|||:......|..||       | 
  Fly   105 DCSSYGCIPRPREINVTRTYVPSHYTNFRK----NDIALLRLETTVQYGDNIRSICLLMGDYTW- 164

  Fly   197 TSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESL----LRRTAFVQSFQLDPT 257
            :|.:..:..:....||||          .:.:|:.|::.::   ||    |...|.|...|||.:
  Fly   165 SSNILKNLVKFNTTGWGR----------TESRINSPVLQQA---SLTHHHLSYCAQVFGKQLDKS 216

  Fly   258 ILCAGGERGRDACIGDGGSPLMCPIP-GHPAIYELVGIVNSG----FSCGLENVPALYTNISHMR 317
            .:|.....| ..|.||.|.||...:. |......|.|:|:.|    |.      |.:|||:.|..
  Fly   217 HICVASSTG-STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG------PTVYTNVIHFA 274

  Fly   318 PWIE 321
            .|||
  Fly   275 NWIE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 74/263 (28%)
Tryp_SPc 90..320 CDD:214473 71/258 (28%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 72/261 (28%)
Tryp_SPc 42..280 CDD:238113 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.