DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG30083

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:282 Identity:66/282 - (23%)
Similarity:118/282 - (41%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NCG--KSNPNGLGGTVEEVVDQAKPNEFPWTVALM----QNLINFFGAGTLVTENIVITAAHLML 128
            |||  ..:|..:.|      ..|:....||...:.    :.:......|||:.:..|::|||.:.
  Fly    24 NCGYPDISPKIMHG------QNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIK 82

  Fly   129 DKTINDFGIIGGAWDLKQLAGK--TIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIG 191
            ...|           |....|:  :.::...|:...:..|...:.:|:|.::.::........|.
  Fly    83 RDQI-----------LAVRLGEHSSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIR 136

  Fly   192 PICWPTSGVSFDRERCL-VAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLD 255
            |||..|........:.. .||||:.:  .:.:|...|.::|..::.|:|.::|       ...:.
  Fly   137 PICIITDPTKVPNVKTFKAAGWGKTE--NETFSKVLKTVELNELNASECYNML-------WVNVT 192

  Fly   256 PTILCAGGERGRDACIGDGGSPLMCPIPGHPAI-YELVGIVNSGFSCGLENVPALYTNISHMRPW 319
            .:.:|||...| |.|.||.|.||:.|:....:: |..:||::.|.|  |.|.|.:||.:|....|
  Fly   193 ESQICAGHPDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSS--LCNSPGVYTRLSSFIDW 254

  Fly   320 IEKQL-NDELNKP----YKTFP 336
            |...: |..:..|    |:.:|
  Fly   255 ILMVVDNYTVRSPPKIQYRVWP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 57/242 (24%)
Tryp_SPc 90..320 CDD:214473 55/237 (23%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 56/250 (22%)
Tryp_SPc 34..255 CDD:238113 56/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.