DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG30082

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:288 Identity:75/288 - (26%)
Similarity:113/288 - (39%) Gaps:80/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NCGKS---NPNG--LGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLD 129
            |||.:   .|..  :||...::      ...||...|.:| .:....|||:|:..|:||||    
  Fly    27 NCGTTINLPPTNRIVGGRTADI------GSNPWLAYLHKN-SSLVCTGTLITKRFVLTAAH---- 80

  Fly   130 KTINDFGIIG---GAWDLKQLAGKTIQWRTATRIVSHPDF--------------------NKMTG 171
             .::.|.::.   |.:|            |:|||....:|                    .:...
  Fly    81 -CLHSFHLLTVRLGEYD------------TSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDS 132

  Fly   172 ANNIALIVLETSFVMKPPIGPICW-------PTSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKI 229
            .|:|.|:.|..:.|.|..|.|||.       |.|. :::     .||||:.|.:  |.:...:.:
  Fly   133 RNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSS-TYE-----AAGWGKIDLI--NTATVLQTV 189

  Fly   230 DLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIP-GHPAIYELVG 293
            :|..:.:||||..||.:.....|       |||..|. |.|.||.|.||...:. |.......:|
  Fly   190 NLIRLDQSDCERSLRTSLSYGQF-------CAGQWRA-DTCSGDSGGPLSRKMSNGRITRTVQLG 246

  Fly   294 IVNSG-FSCGLENVPALYTNISHMRPWI 320
            ||:.| :.|   ..|.:||.:.....||
  Fly   247 IVSYGHYLC---RGPGVYTYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 69/265 (26%)
Tryp_SPc 90..320 CDD:214473 67/261 (26%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 69/274 (25%)
Tryp_SPc 40..274 CDD:238113 71/275 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.