DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG30025

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster


Alignment Length:259 Identity:69/259 - (26%)
Similarity:123/259 - (47%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LGGTVEE---------VVDQAKP--NEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTI 132
            |||||.|         :|..:..  :.|||.::|.::..:..| |::.:.|:::||||.:...:.
  Fly    15 LGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCG-GSIYSSNVIVTAAHCLQSVSA 78

  Fly   133 NDFGIIGGA--WDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPI-- 193
            :...|..|:  |   ...|.|.   :.:...:|..:|..|..|:||:|.:..:......|..|  
  Fly    79 SVLQIRAGSSYW---SSGGVTF---SVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGL 137

  Fly   194 --CWPTSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDP 256
              ..|.:|.:     ..|:|||...:.:.:...:.:.:::.|||:|.|.|    :.:....|:..
  Fly   138 ASSNPANGAA-----ASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCAS----STYGYGSQIRS 193

  Fly   257 TILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWI 320
            |::||... |:|||.||.|.||   :.|.    .|||:|:.|:.|...|.|.:|.:::.:|.|:
  Fly   194 TMICAAAS-GKDACQGDSGGPL---VSGG----VLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 62/241 (26%)
Tryp_SPc 90..320 CDD:214473 61/237 (26%)
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 62/242 (26%)
Tryp_SPc 31..252 CDD:238113 63/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.