DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Ctrb1

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:273 Identity:77/273 - (28%)
Similarity:130/273 - (47%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VIGAPLNCGKSNPNGLGGTVEEVV---------DQAKPNEFPWTVALMQNLINFFGAGTLVTENI 119
            ::||...||..       |::.|:         :.|.|..:||.|:|.......|..|:|::|:.
  Rat    12 LVGATFGCGVP-------TIQPVLTGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDW 69

  Fly   120 VITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSF 184
            |:||||..: || :|. ::.|.:| :....:.||.....::..:|.||..|..|:|.|:.|.|..
  Rat    70 VVTAAHCGV-KT-SDV-VVAGEFD-QGSDEENIQVLKIAQVFKNPKFNMFTVRNDITLLKLATPA 130

  Fly   185 VMKPPIGPICWPTSGVSFDRER-CLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAF 248
            .....:..:|.|.....|.... |...|||:..:.|.....|.::..|||||.:||:        
  Rat   131 QFSETVSAVCLPNVDDDFPPGTVCATTGWGKTKYNALKTPEKLQQAALPIVSEADCK-------- 187

  Fly   249 VQSF--QLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYT 311
             :|:  ::...:.|||.. |..:|:||.|.||:|...|   ::.|.|||:.|......:.||:|:
  Rat   188 -KSWGSKITDVMTCAGAS-GVSSCMGDSGGPLVCQKDG---VWTLAGIVSWGSGVCSTSTPAVYS 247

  Fly   312 NISHMRPWIEKQL 324
            .::.:.||:::.|
  Rat   248 RVTALMPWVQQIL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 70/237 (30%)
Tryp_SPc 90..320 CDD:214473 69/232 (30%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 69/239 (29%)
Tryp_SPc 34..259 CDD:238113 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.