DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and TPSD1

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:227 Identity:64/227 - (28%)
Similarity:98/227 - (43%) Gaps:45/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LGGTVEEVVDQAKPNEFPWTVALMQN---LINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGG 140
            :||      .:|..:::||.|:|...   .::|.| |:|:....|:||||.:..           
Human    39 VGG------QEAPRSKWPWQVSLRVRGPYWMHFCG-GSLIHPQWVLTAAHCVEP----------- 85

  Fly   141 AWDLKQLAGKTIQWR-----------TATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPIC 194
              |:|.||...:|.|           ..:||:.||.|..:....:|||:.||....:...|..:.
Human    86 --DIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSHIHTVT 148

  Fly   195 WPTSGVSFDRER-CLVAGWGRPDFLAKNY----SYKQKKIDLPIVSRSDCESLLRRTAFV-QSFQ 253
            .|.:..:|.... |.|.|||..|   .|.    .|..|::::|:|....|.:........ .|||
Human   149 LPPASETFPPGMPCWVTGWGDVD---NNVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQ 210

  Fly   254 L-DPTILCAGGERGRDACIGDGGSPLMCPIPG 284
            : ...:||||.| ..|:|.||.|.||:|.:.|
Human   211 IVRDDMLCAGSE-NHDSCQGDSGGPLVCKVNG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 62/218 (28%)
Tryp_SPc 90..320 CDD:214473 62/216 (29%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 64/227 (28%)
Tryp_SPc 38..240 CDD:214473 63/224 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.