DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and F10

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:349 Identity:78/349 - (22%)
Similarity:133/349 - (38%) Gaps:74/349 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WTLTETGAPCGLQMECVPQGLCKTSAWNQNAISWPSPC--------QRSESCCHSSQKLVIGAP- 68
            :||.:.|      ..|:|.|              |.||        :||.:...||..   .|| 
Human   155 YTLADNG------KACIPTG--------------PYPCGKQTLERRKRSVAQATSSSG---EAPD 196

  Fly    69 ---------------------LNCGKSNPNGLGGTVEEVV--DQAKPNEFPWTVALMQNLINFFG 110
                                 |:..::.|......:..:|  .:.|..|.||...|:......|.
Human   197 SITWKPYDAADLDPTENPFDLLDFNQTQPERGDNNLTRIVGGQECKDGECPWQALLINEENEGFC 261

  Fly   111 AGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNI 175
            .||:::|..::||||.:..  ...|.:..|..:.:|..|......... ::.|..|.|.|...:|
Human   262 GGTILSEFYILTAAHCLYQ--AKRFKVRVGDRNTEQEEGGEAVHEVEV-VIKHNRFTKETYDFDI 323

  Fly   176 ALIVLETSFVMKPPIGPICWP----TSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSR 236
            |::.|:|....:..:.|.|.|    .......::..:|:|:||.....:. |.:.|.:::|.|.|
Human   324 AVLRLKTPITFRMNVAPACLPERDWAESTLMTQKTGIVSGFGRTHEKGRQ-STRLKMLEVPYVDR 387

  Fly   237 SDCESLLRRTAFVQSFQLDPTILCAGGE-RGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFS 300
            :.|:       ...||.:...:.|||.: :..|||.||.|.|   .:......|.:.|||:.|..
Human   388 NSCK-------LSSSFIITQNMFCAGYDTKQEDACQGDSGGP---HVTRFKDTYFVTGIVSWGEG 442

  Fly   301 CGLENVPALYTNISHMRPWIEKQL 324
            |..:....:||.::....||::.:
Human   443 CARKGKYGIYTKVTAFLKWIDRSM 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 60/239 (25%)
Tryp_SPc 90..320 CDD:214473 58/234 (25%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114 3/14 (21%)
O-glycosylated at one site 183..203 5/22 (23%)
Tryp_SPc 235..464 CDD:238113 61/242 (25%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.